![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
![]() | Superfamily f.4.1: OMPA-like [56925] (4 families) ![]() forms (8,10) barrel |
![]() | Family f.4.1.3: GNA1870 immunodominant domain-like [144097] (1 protein) related to Pfam PF01298; GNA1870 is a bacterial cell surface-exposed lipoprotein |
![]() | Protein Lipoprotein GNA1870 immunodominant domain [144098] (1 species) |
![]() | Species Neisseria meningitidis [TaxId:487] [144099] (1 PDB entry) Uniprot Q6QCC2 120-274 |
![]() | Domain d1ys5a1: 1ys5 A:2-156 [123956] |
PDB Entry: 1ys5 (more details)
SCOP Domain Sequences for d1ys5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ys5a1 f.4.1.3 (A:2-156) Lipoprotein GNA1870 immunodominant domain {Neisseria meningitidis [TaxId: 487]} qshsaltafqteqiqdsehsgkmvakrqfrigdiagehtsfdklpeggratyrgtafgsd daggkltytidfaakqgngkiehlkspelnvdlaaadikpdgkrhavisgsvlynqaekg syslgifggkaqevagsaevktvngirhiglaakq
Timeline for d1ys5a1: