Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.4.1: OMPA-like [56925] (5 families) forms (8,10) barrel |
Family f.4.1.3: GNA1870 immunodominant domain-like [144097] (2 proteins) related to Pfam PF01298; GNA1870 is a bacterial cell surface-exposed lipoprotein |
Protein Lipoprotein GNA1870 immunodominant domain [144098] (1 species) |
Species Neisseria meningitidis [TaxId:487] [144099] (1 PDB entry) Uniprot Q6QCC2 120-274 |
Domain d1ys5a1: 1ys5 A:2-155 [123956] Other proteins in same PDB: d1ys5a2 |
PDB Entry: 1ys5 (more details)
SCOPe Domain Sequences for d1ys5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ys5a1 f.4.1.3 (A:2-155) Lipoprotein GNA1870 immunodominant domain {Neisseria meningitidis [TaxId: 487]} qshsaltafqteqiqdsehsgkmvakrqfrigdiagehtsfdklpeggratyrgtafgsd daggkltytidfaakqgngkiehlkspelnvdlaaadikpdgkrhavisgsvlynqaekg syslgifggkaqevagsaevktvngirhiglaak
Timeline for d1ys5a1: