SCOPe 2.08: Domain d1ys5a1: 1ys5 A:2-155

Lineage for d1ys5a1 (1ys5 A:2-155)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.3: GNA1870 immunodominant domain-like [144097] (2 proteins)
   related to Pfam PF01298; GNA1870 is a bacterial cell surface-exposed lipoprotein

6. Protein Lipoprotein GNA1870 immunodominant domain [144098] (1 species)

7. Species Neisseria meningitidis [TaxId:487] [144099] (1 PDB entry)
   Uniprot Q6QCC2 120-274

8. Domain d1ys5a1: 1ys5 A:2-155 [123956]
   Other proteins in same PDB: d1ys5a2

Details for d1ys5a1

PDB Entry: 1ys5

PDB Description: solution structure of the antigenic domain of gna1870 of neisseria meningitidis

PDB Compounds: (A:) Lipoprotein

SCOPe Domain Sequences for d1ys5a1:

Sequence; same for both SEQRES and ATOM records:

>d1ys5a1 f.4.1.3 (A:2-155) Lipoprotein GNA1870 immunodominant domain {Neisseria meningitidis [TaxId: 487]}
qshsaltafqteqiqdsehsgkmvakrqfrigdiagehtsfdklpeggratyrgtafgsd
daggkltytidfaakqgngkiehlkspelnvdlaaadikpdgkrhavisgsvlynqaekg
syslgifggkaqevagsaevktvngirhiglaak

Timeline for d1ys5a1:

• d1ys5a1 first appeared in SCOP 1.73
  
• d1ys5a1 appears in SCOPe 2.07