SCOPe 2.08: Domain d1yrzb2: 1yrz B:2004-2320

Lineage for d1yrzb2 (1yrz B:2004-2320)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
   automatically mapped to Pfam PF04616

6. Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)

7. Species Bacillus halodurans [TaxId:86665] [141541] (1 PDB entry)
   Uniprot Q9K6P5 4-320

8. Domain d1yrzb2: 1yrz B:2004-2320 [123951]
   Other proteins in same PDB: d1yrza1, d1yrzb1
   automated match to d1yrza2

Details for d1yrzb2

PDB Entry: 1yrz, 2 Å

PDB Description: crystal structure of xylan beta-1,4-xylosidase from bacillus halodurans c-125

PDB Compounds: (B:) xylan beta-1,4-xylosidase

SCOPe Domain Sequences for d1yrzb2:

Sequence; same for both SEQRES and ATOM records:

>d1yrzb2 b.67.2.1 (B:2004-2320) Beta-D-xylosidase N-terminal domain {Bacillus halodurans [TaxId: 86665]}
riqnpilpgfhpdpsivrvgddyyiatstfewfpgvrihhsrdlkhwrfvsspltrtsql
dmkgnmnsggiwapclsyhdgtfyliytdvkqwhgafkdahnylvtaqniegpwsdpiyl
nssgfdpslfhdddgrkwlvnmiwdyrkgnhpfagiilqeyseaeqklvgpvkniykgtd
iqltegphlykkdgyyyllvaeggteyehaatlarsqsidgpyetdpsyplvtstgqpel
alqkaghgslvetqngewylahlcgrplkgkyctlgretaiqkvnwtedgwlriedggnh
plrevtapdlpehpfek

Timeline for d1yrzb2:

• d1yrzb2 first appeared in SCOP 1.73
  
• d1yrzb2 appears in SCOPe 2.07