![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein) |
![]() | Protein Beta-D-xylosidase C-terminal domain [141162] (4 species) |
![]() | Species Bacillus halodurans [TaxId:86665] [141166] (1 PDB entry) Uniprot Q9K6P5 321-525 |
![]() | Domain d1yrzb1: 1yrz B:2321-2525 [123950] Other proteins in same PDB: d1yrza2, d1yrzb2 automated match to d1yrza1 |
PDB Entry: 1yrz (more details), 2 Å
SCOPe Domain Sequences for d1yrzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrzb1 b.29.1.23 (B:2321-2525) Beta-D-xylosidase C-terminal domain {Bacillus halodurans [TaxId: 86665]} epelddfdapqlhhqwntlripadpswcsleerpghlrlrgmesltsvhsqslvarrqqs fhcevetkleyqpesfqhmaglviyydtedhvylhvtwheekgkclqiiqtkggnydell aspiplaeekavylkgrihretmhlyfkqegeaewqpvgptidvthmsddsakqvrftgt fvgmatqdlsgtkkpadfdyfryke
Timeline for d1yrzb1: