Lineage for d1yrzb1 (1yrz B:2321-2525)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051749Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein)
  6. 2051750Protein Beta-D-xylosidase C-terminal domain [141162] (4 species)
  7. 2051751Species Bacillus halodurans [TaxId:86665] [141166] (1 PDB entry)
    Uniprot Q9K6P5 321-525
  8. 2051753Domain d1yrzb1: 1yrz B:2321-2525 [123950]
    Other proteins in same PDB: d1yrza2, d1yrzb2
    automated match to d1yrza1

Details for d1yrzb1

PDB Entry: 1yrz (more details), 2 Å

PDB Description: crystal structure of xylan beta-1,4-xylosidase from bacillus halodurans c-125
PDB Compounds: (B:) xylan beta-1,4-xylosidase

SCOPe Domain Sequences for d1yrzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrzb1 b.29.1.23 (B:2321-2525) Beta-D-xylosidase C-terminal domain {Bacillus halodurans [TaxId: 86665]}
epelddfdapqlhhqwntlripadpswcsleerpghlrlrgmesltsvhsqslvarrqqs
fhcevetkleyqpesfqhmaglviyydtedhvylhvtwheekgkclqiiqtkggnydell
aspiplaeekavylkgrihretmhlyfkqegeaewqpvgptidvthmsddsakqvrftgt
fvgmatqdlsgtkkpadfdyfryke

SCOPe Domain Coordinates for d1yrzb1:

Click to download the PDB-style file with coordinates for d1yrzb1.
(The format of our PDB-style files is described here.)

Timeline for d1yrzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yrzb2