SCOPe 2.08: Domain d1yrzb1: 1yrz B:2321-2525

Lineage for d1yrzb1 (1yrz B:2321-2525)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein)

6. Protein Beta-D-xylosidase C-terminal domain [141162] (4 species)

7. Species Bacillus halodurans [TaxId:86665] [141166] (1 PDB entry)
   Uniprot Q9K6P5 321-525

8. Domain d1yrzb1: 1yrz B:2321-2525 [123950]
   Other proteins in same PDB: d1yrza2, d1yrzb2
   automated match to d1yrza1

Details for d1yrzb1

PDB Entry: 1yrz, 2 Å

PDB Description: crystal structure of xylan beta-1,4-xylosidase from bacillus halodurans c-125

PDB Compounds: (B:) xylan beta-1,4-xylosidase

SCOPe Domain Sequences for d1yrzb1:

Sequence; same for both SEQRES and ATOM records:

>d1yrzb1 b.29.1.23 (B:2321-2525) Beta-D-xylosidase C-terminal domain {Bacillus halodurans [TaxId: 86665]}
epelddfdapqlhhqwntlripadpswcsleerpghlrlrgmesltsvhsqslvarrqqs
fhcevetkleyqpesfqhmaglviyydtedhvylhvtwheekgkclqiiqtkggnydell
aspiplaeekavylkgrihretmhlyfkqegeaewqpvgptidvthmsddsakqvrftgt
fvgmatqdlsgtkkpadfdyfryke

Timeline for d1yrzb1:

• d1yrzb1 first appeared in SCOP 1.73
  
• d1yrzb1 appears in SCOPe 2.07