![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) ![]() |
![]() | Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins) automatically mapped to Pfam PF04616 |
![]() | Protein Beta-D-xylosidase N-terminal domain [141538] (4 species) |
![]() | Species Bacillus halodurans [TaxId:86665] [141541] (1 PDB entry) Uniprot Q9K6P5 4-320 |
![]() | Domain d1yrza2: 1yrz A:1004-1320 [123949] Other proteins in same PDB: d1yrza1, d1yrzb1 |
PDB Entry: 1yrz (more details), 2 Å
SCOPe Domain Sequences for d1yrza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrza2 b.67.2.1 (A:1004-1320) Beta-D-xylosidase N-terminal domain {Bacillus halodurans [TaxId: 86665]} riqnpilpgfhpdpsivrvgddyyiatstfewfpgvrihhsrdlkhwrfvsspltrtsql dmkgnmnsggiwapclsyhdgtfyliytdvkqwhgafkdahnylvtaqniegpwsdpiyl nssgfdpslfhdddgrkwlvnmiwdyrkgnhpfagiilqeyseaeqklvgpvkniykgtd iqltegphlykkdgyyyllvaeggteyehaatlarsqsidgpyetdpsyplvtstgqpel alqkaghgslvetqngewylahlcgrplkgkyctlgretaiqkvnwtedgwlriedggnh plrevtapdlpehpfek
Timeline for d1yrza2: