Lineage for d1yrza2 (1yrz A:1004-1320)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074534Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2074544Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2074545Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 2074559Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)
  7. 2074560Species Bacillus halodurans [TaxId:86665] [141541] (1 PDB entry)
    Uniprot Q9K6P5 4-320
  8. 2074561Domain d1yrza2: 1yrz A:1004-1320 [123949]
    Other proteins in same PDB: d1yrza1, d1yrzb1

Details for d1yrza2

PDB Entry: 1yrz (more details), 2 Å

PDB Description: crystal structure of xylan beta-1,4-xylosidase from bacillus halodurans c-125
PDB Compounds: (A:) xylan beta-1,4-xylosidase

SCOPe Domain Sequences for d1yrza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrza2 b.67.2.1 (A:1004-1320) Beta-D-xylosidase N-terminal domain {Bacillus halodurans [TaxId: 86665]}
riqnpilpgfhpdpsivrvgddyyiatstfewfpgvrihhsrdlkhwrfvsspltrtsql
dmkgnmnsggiwapclsyhdgtfyliytdvkqwhgafkdahnylvtaqniegpwsdpiyl
nssgfdpslfhdddgrkwlvnmiwdyrkgnhpfagiilqeyseaeqklvgpvkniykgtd
iqltegphlykkdgyyyllvaeggteyehaatlarsqsidgpyetdpsyplvtstgqpel
alqkaghgslvetqngewylahlcgrplkgkyctlgretaiqkvnwtedgwlriedggnh
plrevtapdlpehpfek

SCOPe Domain Coordinates for d1yrza2:

Click to download the PDB-style file with coordinates for d1yrza2.
(The format of our PDB-style files is described here.)

Timeline for d1yrza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yrza1