Lineage for d1yrza1 (1yrz A:1321-1525)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390226Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein)
  6. 2390227Protein Beta-D-xylosidase C-terminal domain [141162] (4 species)
  7. 2390228Species Bacillus halodurans [TaxId:86665] [141166] (1 PDB entry)
    Uniprot Q9K6P5 321-525
  8. 2390229Domain d1yrza1: 1yrz A:1321-1525 [123948]
    Other proteins in same PDB: d1yrza2, d1yrzb2

Details for d1yrza1

PDB Entry: 1yrz (more details), 2 Å

PDB Description: crystal structure of xylan beta-1,4-xylosidase from bacillus halodurans c-125
PDB Compounds: (A:) xylan beta-1,4-xylosidase

SCOPe Domain Sequences for d1yrza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrza1 b.29.1.23 (A:1321-1525) Beta-D-xylosidase C-terminal domain {Bacillus halodurans [TaxId: 86665]}
epelddfdapqlhhqwntlripadpswcsleerpghlrlrgmesltsvhsqslvarrqqs
fhcevetkleyqpesfqhmaglviyydtedhvylhvtwheekgkclqiiqtkggnydell
aspiplaeekavylkgrihretmhlyfkqegeaewqpvgptidvthmsddsakqvrftgt
fvgmatqdlsgtkkpadfdyfryke

SCOPe Domain Coordinates for d1yrza1:

Click to download the PDB-style file with coordinates for d1yrza1.
(The format of our PDB-style files is described here.)

Timeline for d1yrza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yrza2