SCOPe 2.02: Domain d1yrxb_: 1yrx B:

Lineage for d1yrxb_ (1yrx B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families)

5. Family d.58.10.2: BLUF domain [143364] (4 proteins)
   Pfam PF04940; sensors of blue-light using FAD

6. Protein automated matches [190725] (2 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:272943] [188152] (1 PDB entry)

8. Domain d1yrxb_: 1yrx B: [123945]
   Other proteins in same PDB: d1yrxa1
   automated match to d1yrxa1
   complexed with d9g, fmn

Details for d1yrxb_

PDB Entry: 1yrx, 2.3 Å

PDB Description: Structure of a novel photoreceptor: the BLUF domain of AppA from Rhodobacter sphaeroides

PDB Compounds: (B:) hypothetical protein Rsph03001874

SCOPe Domain Sequences for d1yrxb_:

Sequence; same for both SEQRES and ATOM records:

>d1yrxb_ d.58.10.2 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
ghmvsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaava
evmthiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslglaesrqivtv

Timeline for d1yrxb_:

• d1yrxb_ first appeared in SCOP 1.73, called d1yrxb1
  
• d1yrxb_ appears in SCOPe 2.01
  
• d1yrxb_ appears in SCOPe 2.03
  
• d1yrxb_ appears in the current release, SCOPe 2.08, called d1yrxb2