![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) ![]() |
![]() | Family d.58.10.2: BLUF domain [143364] (4 proteins) Pfam PF04940; sensors of blue-light using FAD |
![]() | Protein automated matches [190725] (2 species) not a true protein |
![]() | Species Rhodobacter sphaeroides [TaxId:272943] [188152] (1 PDB entry) |
![]() | Domain d1yrxb2: 1yrx B:17-129 [123945] Other proteins in same PDB: d1yrxa1, d1yrxa2, d1yrxb3, d1yrxc3 automated match to d1yrxa1 complexed with d9g, fmn |
PDB Entry: 1yrx (more details), 2.3 Å
SCOPe Domain Sequences for d1yrxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrxb2 d.58.10.2 (B:17-129) automated matches {Rhodobacter sphaeroides [TaxId: 272943]} vsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaavaevm thiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslglaesrqivtv
Timeline for d1yrxb2:
![]() Domains from other chains: (mouse over for more information) d1yrxa1, d1yrxa2, d1yrxc2, d1yrxc3 |