Lineage for d1yrxb2 (1yrx B:17-129)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953323Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2953361Family d.58.10.2: BLUF domain [143364] (4 proteins)
    Pfam PF04940; sensors of blue-light using FAD
  6. 2953382Protein automated matches [190725] (2 species)
    not a true protein
  7. 2953388Species Rhodobacter sphaeroides [TaxId:272943] [188152] (1 PDB entry)
  8. 2953389Domain d1yrxb2: 1yrx B:17-129 [123945]
    Other proteins in same PDB: d1yrxa1, d1yrxa2, d1yrxb3, d1yrxc3
    automated match to d1yrxa1
    complexed with d9g, fmn

Details for d1yrxb2

PDB Entry: 1yrx (more details), 2.3 Å

PDB Description: Structure of a novel photoreceptor: the BLUF domain of AppA from Rhodobacter sphaeroides
PDB Compounds: (B:) hypothetical protein Rsph03001874

SCOPe Domain Sequences for d1yrxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrxb2 d.58.10.2 (B:17-129) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
vsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaavaevm
thiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslglaesrqivtv

SCOPe Domain Coordinates for d1yrxb2:

Click to download the PDB-style file with coordinates for d1yrxb2.
(The format of our PDB-style files is described here.)

Timeline for d1yrxb2: