SCOPe 2.05: Domain d1yrxa1: 1yrx A:17-130

Lineage for d1yrxa1 (1yrx A:17-130)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families)

5. Family d.58.10.2: BLUF domain [143364] (4 proteins)
   Pfam PF04940; sensors of blue-light using FAD

6. Protein Sensor of blue light AppA [143367] (1 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [143368] (2 PDB entries)
   Uniprot Q53119 17-130! Uniprot Q53119 5-125

8. Domain d1yrxa1: 1yrx A:17-130 [123944]
   Other proteins in same PDB: d1yrxb_, d1yrxc_
   complexed with d9g, fmn

Details for d1yrxa1

PDB Entry: 1yrx, 2.3 Å

PDB Description: Structure of a novel photoreceptor: the BLUF domain of AppA from Rhodobacter sphaeroides

PDB Compounds: (A:) hypothetical protein Rsph03001874

SCOPe Domain Sequences for d1yrxa1:

Sequence; same for both SEQRES and ATOM records:

>d1yrxa1 d.58.10.2 (A:17-130) Sensor of blue light AppA {Rhodobacter sphaeroides [TaxId: 1063]}
vsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaavaevm
thiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslglaesrqivtvg

Timeline for d1yrxa1:

• d1yrxa1 first appeared in SCOP 1.73
  
• d1yrxa1 appears in SCOPe 2.04
  
• d1yrxa1 appears in SCOPe 2.06
  
• d1yrxa1 appears in the current release, SCOPe 2.08