![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) ![]() |
![]() | Family d.58.10.2: BLUF domain [143364] (4 proteins) Pfam PF04940; sensors of blue-light using FAD |
![]() | Protein Sensor of blue light AppA [143367] (1 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [143368] (2 PDB entries) Uniprot Q53119 17-130! Uniprot Q53119 5-125 |
![]() | Domain d1yrxa1: 1yrx A:17-130 [123944] Other proteins in same PDB: d1yrxb_, d1yrxc_ complexed with d9g, fmn |
PDB Entry: 1yrx (more details), 2.3 Å
SCOPe Domain Sequences for d1yrxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrxa1 d.58.10.2 (A:17-130) Sensor of blue light AppA {Rhodobacter sphaeroides [TaxId: 1063]} vsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaavaevm thiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslglaesrqivtvg
Timeline for d1yrxa1: