Lineage for d1yrwa2 (1yrw A:1-203)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144933Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2144934Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2144935Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2145016Protein Polymyxin resistance protein ArnA, N-terminal domain [142569] (1 species)
  7. 2145017Species Escherichia coli [TaxId:562] [142570] (4 PDB entries)
    Uniprot P77398 1-200! Uniprot P77398 1-203
  8. 2145020Domain d1yrwa2: 1yrw A:1-203 [123943]
    Other proteins in same PDB: d1yrwa1
    automated match to d2blna2

Details for d1yrwa2

PDB Entry: 1yrw (more details), 1.7 Å

PDB Description: Crystal Structure of E.coli ArnA Transformylase Domain
PDB Compounds: (A:) protein ArnA

SCOPe Domain Sequences for d1yrwa2:

Sequence, based on SEQRES records: (download)

>d1yrwa2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]}
mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
khgnileiaqreneatcfgrrtp

Sequence, based on observed residues (ATOM records): (download)

>d1yrwa2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]}
mktvvfayhdmgclgieallaagyeisaifthtdfygsvarlaaergipvyapdnvnhpl
wveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvnget
etgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgnil
eiaqreneatcfgrrtp

SCOPe Domain Coordinates for d1yrwa2:

Click to download the PDB-style file with coordinates for d1yrwa2.
(The format of our PDB-style files is described here.)

Timeline for d1yrwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yrwa1