SCOPe 2.06: Domain d1yrva1: 1yrv A:1-148

Lineage for d1yrva1 (1yrv A:1-148)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Human (Homo sapiens), E2 U [TaxId:9606] [143053] (1 PDB entry)
   Uniprot Q5VVX9 1-148

8. Domain d1yrva1: 1yrv A:1-148 [123941]
   Other proteins in same PDB: d1yrva2

Details for d1yrva1

PDB Entry: 1yrv, 2.18 Å

PDB Description: novel ubiquitin-conjugating enzyme

PDB Compounds: (A:) ubiquitin-conjugating ligase MGC351130

SCOPe Domain Sequences for d1yrva1:

Sequence; same for both SEQRES and ATOM records:

>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]}
mhgraylllhrdfcdlkennykgitakpvsedmmeweveieglqnsvwqglvfqltihft
seynyappvvkfitipfhpnvdphtgqpcidfldnpekwntnytlssillalqvmlsnpv
lenpvnleaarilvkdeslyrtilrlfn

Timeline for d1yrva1:

• d1yrva1 first appeared in SCOP 1.73
  
• d1yrva1 appears in SCOPe 2.05
  
• d1yrva1 appears in SCOPe 2.07
  
• d1yrva1 appears in the current release, SCOPe 2.08