Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Human (Homo sapiens), E2 U [TaxId:9606] [143053] (1 PDB entry) Uniprot Q5VVX9 1-148 |
Domain d1yrva1: 1yrv A:1-148 [123941] |
PDB Entry: 1yrv (more details), 2.18 Å
SCOPe Domain Sequences for d1yrva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} mhgraylllhrdfcdlkennykgitakpvsedmmeweveieglqnsvwqglvfqltihft seynyappvvkfitipfhpnvdphtgqpcidfldnpekwntnytlssillalqvmlsnpv lenpvnleaarilvkdeslyrtilrlfn
Timeline for d1yrva1: