Lineage for d1yrva1 (1yrv A:1-148)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1406955Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1407013Species Human (Homo sapiens), E2 U [TaxId:9606] [143053] (1 PDB entry)
    Uniprot Q5VVX9 1-148
  8. 1407014Domain d1yrva1: 1yrv A:1-148 [123941]

Details for d1yrva1

PDB Entry: 1yrv (more details), 2.18 Å

PDB Description: novel ubiquitin-conjugating enzyme
PDB Compounds: (A:) ubiquitin-conjugating ligase MGC351130

SCOPe Domain Sequences for d1yrva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]}
mhgraylllhrdfcdlkennykgitakpvsedmmeweveieglqnsvwqglvfqltihft
seynyappvvkfitipfhpnvdphtgqpcidfldnpekwntnytlssillalqvmlsnpv
lenpvnleaarilvkdeslyrtilrlfn

SCOPe Domain Coordinates for d1yrva1:

Click to download the PDB-style file with coordinates for d1yrva1.
(The format of our PDB-style files is described here.)

Timeline for d1yrva1: