Lineage for d1yrrb2 (1yrr B:54-350)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442516Family c.1.9.10: N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82261] (1 protein)
    automatically mapped to Pfam PF01979
  6. 2442517Protein N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82262] (3 species)
  7. 2442521Species Escherichia coli [TaxId:562] [141808] (4 PDB entries)
    Uniprot P0AF18 54-350
  8. 2442523Domain d1yrrb2: 1yrr B:54-350 [123938]
    Other proteins in same PDB: d1yrra1, d1yrrb1
    automated match to d1ymya2
    complexed with gol, po4

Details for d1yrrb2

PDB Entry: 1yrr (more details), 2 Å

PDB Description: Crystal Structure Of The N-Acetylglucosamine-6-Phosphate Deacetylase From Escherichia Coli K12 at 2.0 A Resolution
PDB Compounds: (B:) N-acetylglucosamine-6-phosphate deacetylase

SCOPe Domain Sequences for d1yrrb2:

Sequence, based on SEQRES records: (download)

>d1yrrb2 c.1.9.10 (B:54-350) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Escherichia coli [TaxId: 562]}
gfidvqlngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrv
mreylakhpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlap
emvpaevisklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglag
aildeadiycgiiadglhvdyanirnakrlkgdklclvtdatapaganieqfifagktiy
yrnglcvdengtlsgssltmiegvrnlvehcgialdevlrmatlyparaigvekrlg

Sequence, based on observed residues (ATOM records): (download)

>d1yrrb2 c.1.9.10 (B:54-350) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Escherichia coli [TaxId: 562]}
gfidvqlngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrv
mreylakhpnqalglhlegpwlnaalvdflcenadvitkvtlapemvpaevisklanagi
vvsaghsnatlkeakagfragitfathlynampyitgrepglagaildeadiycgiiadg
lhvdyanirnakrlkgdklclvtdatsgssltmiegvrnlvehcgialdevlrmatlypa
raigvekrlg

SCOPe Domain Coordinates for d1yrrb2:

Click to download the PDB-style file with coordinates for d1yrrb2.
(The format of our PDB-style files is described here.)

Timeline for d1yrrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yrrb1