Class b: All beta proteins [48724] (180 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein) |
Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (3 species) |
Species Escherichia coli [TaxId:562] [141688] (4 PDB entries) Uniprot P0AF18 1-53,351-382 |
Domain d1yrrb1: 1yrr B:2-53,B:351-382 [123937] Other proteins in same PDB: d1yrra2, d1yrrb2 automated match to d1ymya1 complexed with gol, po4 |
PDB Entry: 1yrr (more details), 2 Å
SCOPe Domain Sequences for d1yrrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrrb1 b.92.1.5 (B:2-53,B:351-382) N-acetylglucosamine-6-phosphate deacetylase, NagA {Escherichia coli [TaxId: 562]} yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspXtlaagkv anltaftpdfkitktivngnevvtq
Timeline for d1yrrb1: