SCOPe 2.07: Domain d1yroc_: 1yro C:

Lineage for d1yroc_ (1yro C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Mouse (Mus musculus) [TaxId:10090] [69628] (14 PDB entries)

8. Domain d1yroc_: 1yro C: [123933]
   Other proteins in same PDB: d1yrob1, d1yrod_
   automated match to d1nf5a_
   complexed with ca, gdu, mes, mn, pg4, udp; mutant

Details for d1yroc_

PDB Entry: 1yro, 1.9 Å

PDB Description: crystal structure of beta14,-galactosyltransferase mutant arg228lys in complex with alpha-lactalbumin in the presence of udp-galactose and mn

PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1yroc_:

Sequence; same for both SEQRES and ATOM records:

>d1yroc_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

Timeline for d1yroc_:

• d1yroc_ first appeared in SCOP 1.73, called d1yroc1
  
• d1yroc_ appears in SCOPe 2.06
  
• d1yroc_ appears in the current release, SCOPe 2.08