![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
![]() | Protein alpha-Lactalbumin [53975] (6 species) expressed only in the lactating mammary gland, strongly binds calcium ion |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [69628] (14 PDB entries) |
![]() | Domain d1yroc_: 1yro C: [123933] Other proteins in same PDB: d1yrob1, d1yrod_ automated match to d1nf5a_ complexed with ca, gdu, mes, mn, pg4, udp; mutant |
PDB Entry: 1yro (more details), 1.9 Å
SCOPe Domain Sequences for d1yroc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yroc_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]} teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc ekp
Timeline for d1yroc_: