Lineage for d1yrob1 (1yro B:131-402)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149496Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2149497Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2149506Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 2149507Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 2149508Species Cow (Bos taurus) [TaxId:9913] [53454] (30 PDB entries)
    Uniprot P08037 131-402
  8. 2149510Domain d1yrob1: 1yro B:131-402 [123932]
    Other proteins in same PDB: d1yroa_, d1yroc_
    complexed with ca, gdu, mes, mn, pg4, udp; mutant

Details for d1yrob1

PDB Entry: 1yro (more details), 1.9 Å

PDB Description: crystal structure of beta14,-galactosyltransferase mutant arg228lys in complex with alpha-lactalbumin in the presence of udp-galactose and mn
PDB Compounds: (B:) beta-1,4-galactosyltransferase

SCOPe Domain Sequences for d1yrob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrob1 c.68.1.2 (B:131-402) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}
ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
rqehlkywlyylhpilqrqqldygiyvinqagesmfnkakllnvgfkealkdydyncfvf
sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
ywgwggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepnpqrfdriahtketm
lsdglnsltymvlevqryplytkitvdigtps

SCOPe Domain Coordinates for d1yrob1:

Click to download the PDB-style file with coordinates for d1yrob1.
(The format of our PDB-style files is described here.)

Timeline for d1yrob1: