![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (8 families) ![]() |
![]() | Family c.23.5.8: WrbA-like [117474] (2 proteins) |
![]() | Protein Trp repressor binding protein WrbA [117475] (2 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [117476] (2 PDB entries) Uniprot Q9RYU4 |
![]() | Domain d1yrhh1: 1yrh H:4-199 [123930] automatically matched to 1YRH A:4-199 complexed with fmn |
PDB Entry: 1yrh (more details), 3.11 Å
SCOP Domain Sequences for d1yrhh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrhh1 c.23.5.8 (H:4-199) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} pvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieam kdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaq nvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendras irhqvrrqveltakll
Timeline for d1yrhh1: