Lineage for d1yrhc1 (1yrh C:4-199)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825904Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 826166Family c.23.5.8: WrbA-like [117474] (2 proteins)
  6. 826175Protein Trp repressor binding protein WrbA [117475] (2 species)
  7. 826176Species Deinococcus radiodurans [TaxId:1299] [117476] (2 PDB entries)
    Uniprot Q9RYU4
  8. 826187Domain d1yrhc1: 1yrh C:4-199 [123925]
    automatically matched to 1YRH A:4-199
    complexed with fmn

Details for d1yrhc1

PDB Entry: 1yrh (more details), 3.11 Å

PDB Description: crystal structure of trp repressor binding protein wrba in complex with fmn
PDB Compounds: (C:) Trp repressor binding protein WrbA

SCOP Domain Sequences for d1yrhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrhc1 c.23.5.8 (C:4-199) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]}
pvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieam
kdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaq
nvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendras
irhqvrrqveltakll

SCOP Domain Coordinates for d1yrhc1:

Click to download the PDB-style file with coordinates for d1yrhc1.
(The format of our PDB-style files is described here.)

Timeline for d1yrhc1: