SCOP 1.73: Domain d1yrec1: 1yre C:12-193

Lineage for d1yrec1 (1yre C:12-193)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)

6. Protein Hypothetical protein PA3270 [143686] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [143687] (1 PDB entry)

8. Domain d1yrec1: 1yre C:12-193 [123921]
   automatically matched to 1YRE A:11-193
   complexed with coa

Details for d1yrec1

PDB Entry: 1yre, 2.15 Å

PDB Description: hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa

PDB Compounds: (C:) hypothetical protein PA3270

SCOP Domain Sequences for d1yrec1:

Sequence; same for both SEQRES and ATOM records:

>d1yrec1 d.108.1.1 (C:12-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]}
pitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregralpl
avrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnlrmvr
vqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvkaalea
sf

Timeline for d1yrec1:

• d1yrec1 is new in SCOP 1.73
  
• d1yrec1 appears in SCOP 1.75
  
• d1yrec1 appears in the current release, SCOPe 2.08, called d1yrec_