Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins) |
Protein Hypothetical protein PA3270 [143686] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [143687] (1 PDB entry) |
Domain d1yrec1: 1yre C:12-193 [123921] automatically matched to 1YRE A:11-193 complexed with coa |
PDB Entry: 1yre (more details), 2.15 Å
SCOP Domain Sequences for d1yrec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrec1 d.108.1.1 (C:12-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} pitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregralpl avrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnlrmvr vqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvkaalea sf
Timeline for d1yrec1: