Lineage for d1yreb_ (1yre B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1426875Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1427215Protein automated matches [190241] (10 species)
    not a true protein
  7. 1427257Species Pseudomonas aeruginosa [TaxId:208964] [187674] (2 PDB entries)
  8. 1427258Domain d1yreb_: 1yre B: [123920]
    Other proteins in same PDB: d1yrea1
    automated match to d1yrea1
    complexed with coa

Details for d1yreb_

PDB Entry: 1yre (more details), 2.15 Å

PDB Description: hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
PDB Compounds: (B:) hypothetical protein PA3270

SCOPe Domain Sequences for d1yreb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yreb_ d.108.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
fkplpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregr
alplavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnl
rmvrvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvka
aleasft

SCOPe Domain Coordinates for d1yreb_:

Click to download the PDB-style file with coordinates for d1yreb_.
(The format of our PDB-style files is described here.)

Timeline for d1yreb_: