Lineage for d1yreb1 (1yre B:11-193)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870001Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 870002Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) (S)
  5. 870003Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins)
  6. 870141Protein Hypothetical protein PA3270 [143686] (1 species)
  7. 870142Species Pseudomonas aeruginosa [TaxId:287] [143687] (1 PDB entry)
    Uniprot Q9HYX1 11-193
  8. 870144Domain d1yreb1: 1yre B:11-193 [123920]
    automatically matched to 1YRE A:11-193
    complexed with coa

Details for d1yreb1

PDB Entry: 1yre (more details), 2.15 Å

PDB Description: hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
PDB Compounds: (B:) hypothetical protein PA3270

SCOP Domain Sequences for d1yreb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yreb1 d.108.1.1 (B:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]}
lpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregralp
lavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnlrmv
rvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvkaale
asf

SCOP Domain Coordinates for d1yreb1:

Click to download the PDB-style file with coordinates for d1yreb1.
(The format of our PDB-style files is described here.)

Timeline for d1yreb1: