Lineage for d1yrea1 (1yre A:11-193)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921280Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1921421Protein Hypothetical protein PA3270 [143686] (1 species)
  7. 1921422Species Pseudomonas aeruginosa [TaxId:287] [143687] (1 PDB entry)
    Uniprot Q9HYX1 11-193
  8. 1921423Domain d1yrea1: 1yre A:11-193 [123919]
    Other proteins in same PDB: d1yreb_, d1yrec_, d1yred_
    complexed with coa

Details for d1yrea1

PDB Entry: 1yre (more details), 2.15 Å

PDB Description: hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
PDB Compounds: (A:) hypothetical protein PA3270

SCOPe Domain Sequences for d1yrea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]}
lpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregralp
lavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnlrmv
rvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvkaale
asf

SCOPe Domain Coordinates for d1yrea1:

Click to download the PDB-style file with coordinates for d1yrea1.
(The format of our PDB-style files is described here.)

Timeline for d1yrea1: