![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins) |
![]() | Protein Hypothetical protein PA3270 [143686] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [143687] (1 PDB entry) |
![]() | Domain d1yrea1: 1yre A:11-193 [123919] complexed with coa |
PDB Entry: 1yre (more details), 2.15 Å
SCOP Domain Sequences for d1yrea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} lpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregralp lavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnlrmv rvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvkaale asf
Timeline for d1yrea1: