SCOPe 2.08: Domain d1yrbb2: 1yrb B:1-246

Lineage for d1yrbb2 (1yrb B:1-246)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein ATP(GTP)-binding protein PAB0955 [142297] (1 species)
   PYRAB14380; belongs to Pfam PF03029

7. Species Pyrococcus abyssi [TaxId:29292] [142298] (7 PDB entries)
   Uniprot Q9UYR9 30-273

8. Domain d1yrbb2: 1yrb B:1-246 [123916]
   Other proteins in same PDB: d1yrba3, d1yrbb3
   automated match to d1yr6a1
   complexed with gdp, mg

Details for d1yrbb2

PDB Entry: 1yrb, 1.75 Å

PDB Description: pab0955 crystal structure : a gtpase in gdp and mg bound form from pyrococcus abyssi

PDB Compounds: (B:) ATP(GTP)binding protein

SCOPe Domain Sequences for d1yrbb2:

Sequence; same for both SEQRES and ATOM records:

>d1yrbb2 c.37.1.10 (B:1-246) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}
mivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyepsidvrefvtveeim
regygpngaivesydrlmekfneylnkilrlekendyvlidtpgqmetflfhefgvrlme
nlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnkvdllseeekerhrk
yfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsaktregfedletlayeh
yctcgd

Timeline for d1yrbb2:

• d1yrbb2 first appeared in SCOP 1.73, called d1yrbb1
  
• d1yrbb2 appears in SCOPe 2.07