![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
![]() | Protein ATP(GTP)-binding protein PAB0955 [142297] (1 species) PYRAB14380; belongs to Pfam PF03029 |
![]() | Species Pyrococcus abyssi [TaxId:29292] [142298] (7 PDB entries) Uniprot Q9UYR9 30-273 |
![]() | Domain d1yrbb2: 1yrb B:1-246 [123916] Other proteins in same PDB: d1yrba3, d1yrbb3 automated match to d1yr6a1 complexed with gdp, mg |
PDB Entry: 1yrb (more details), 1.75 Å
SCOPe Domain Sequences for d1yrbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrbb2 c.37.1.10 (B:1-246) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} mivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyepsidvrefvtveeim regygpngaivesydrlmekfneylnkilrlekendyvlidtpgqmetflfhefgvrlme nlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnkvdllseeekerhrk yfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsaktregfedletlayeh yctcgd
Timeline for d1yrbb2: