| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.10: Nitrogenase iron protein-like [52652] (15 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
| Protein ATP(GTP)-binding protein PAB0955 [142297] (1 species) PYRAB14380; belongs to Pfam PF03029 |
| Species Pyrococcus abyssi [TaxId:29292] [142298] (7 PDB entries) Uniprot Q9UYR9 30-273 |
| Domain d1yrab1: 1yra B:1-244 [123914] automatically matched to 1YR6 A:1-244 complexed with gdp |
PDB Entry: 1yra (more details), 2.3 Å
SCOP Domain Sequences for d1yrab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrab1 c.37.1.10 (B:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}
mivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyepsidvrefvtveeim
regygpngaivesydrlmekfneylnkilrlekendyvlidtpgqmetflfhefgvrlme
nlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnkvdllseeekerhrk
yfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsaktregfedletlayeh
yctc
Timeline for d1yrab1: