SCOP 1.75: Domain d1yr8a1: 1yr8 A:1-244

Lineage for d1yr8a1 (1yr8 A:1-244)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (15 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein ATP(GTP)-binding protein PAB0955 [142297] (1 species)
   PYRAB14380; belongs to Pfam PF03029

7. Species Pyrococcus abyssi [TaxId:29292] [142298] (7 PDB entries)
   Uniprot Q9UYR9 30-273

8. Domain d1yr8a1: 1yr8 A:1-244 [123911]
   automatically matched to 1YR6 A:1-244
   complexed with gtp

Details for d1yr8a1

PDB Entry: 1yr8, 2.4 Å

PDB Description: pab0955 crystal structure : a gtpase in gtp bound form from pyrococcus abyssi

PDB Compounds: (A:) ATP(GTP)binding protein

SCOP Domain Sequences for d1yr8a1:

Sequence; same for both SEQRES and ATOM records:

>d1yr8a1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}
mivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyepsidvrefvtveeim
regygpngaivesydrlmekfneylnkilrlekendyvlidtpgqmetflfhefgvrlme
nlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnkvdllseeekerhrk
yfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsaktregfedletlayeh
yctc

Timeline for d1yr8a1:

• d1yr8a1 first appeared in SCOP 1.73
  
• d1yr8a1 is called d1yr8a_ in SCOPe 2.01
  
• d1yr8a1 appears in the current release, SCOPe 2.08, called d1yr8a2