Lineage for d1yr8a1 (1yr8 A:1-244)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 830941Family c.37.1.10: Nitrogenase iron protein-like [52652] (15 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 831007Protein ATP(GTP)-binding protein PAB0955 [142297] (1 species)
    PYRAB14380; belongs to Pfam PF03029
  7. 831008Species Pyrococcus abyssi [TaxId:29292] [142298] (7 PDB entries)
    Uniprot Q9UYR9 30-273
  8. 831016Domain d1yr8a1: 1yr8 A:1-244 [123911]
    automatically matched to 1YR6 A:1-244
    complexed with gtp

Details for d1yr8a1

PDB Entry: 1yr8 (more details), 2.4 Å

PDB Description: pab0955 crystal structure : a gtpase in gtp bound form from pyrococcus abyssi
PDB Compounds: (A:) ATP(GTP)binding protein

SCOP Domain Sequences for d1yr8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yr8a1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}
mivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyepsidvrefvtveeim
regygpngaivesydrlmekfneylnkilrlekendyvlidtpgqmetflfhefgvrlme
nlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnkvdllseeekerhrk
yfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsaktregfedletlayeh
yctc

SCOP Domain Coordinates for d1yr8a1:

Click to download the PDB-style file with coordinates for d1yr8a1.
(The format of our PDB-style files is described here.)

Timeline for d1yr8a1: