Lineage for d1yr7a_ (1yr7 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1847600Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1847665Protein ATP(GTP)-binding protein PAB0955 [142297] (1 species)
    PYRAB14380; belongs to Pfam PF03029
  7. 1847666Species Pyrococcus abyssi [TaxId:29292] [142298] (7 PDB entries)
    Uniprot Q9UYR9 30-273
  8. 1847669Domain d1yr7a_: 1yr7 A: [123910]
    automated match to d1yr6a1
    complexed with gsp

Details for d1yr7a_

PDB Entry: 1yr7 (more details), 2.08 Å

PDB Description: pab0955 crystal structure : a gtpase in gtp-gamma-s bound form from pyrococcus abyssi
PDB Compounds: (A:) ATP(GTP)binding protein

SCOPe Domain Sequences for d1yr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yr7a_ c.37.1.10 (A:) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}
smivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyepsidvrefvtveei
mregygpngaivesydrlmekfneylnkilrlekendyvlidtpgqmetflfhefgvrlm
enlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnkvdllseeekerhr
kyfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsaktregfedletlaye
hyc

SCOPe Domain Coordinates for d1yr7a_:

Click to download the PDB-style file with coordinates for d1yr7a_.
(The format of our PDB-style files is described here.)

Timeline for d1yr7a_: