Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
Protein ATP(GTP)-binding protein PAB0955 [142297] (1 species) PYRAB14380; belongs to Pfam PF03029 |
Species Pyrococcus abyssi [TaxId:29292] [142298] (7 PDB entries) Uniprot Q9UYR9 30-273 |
Domain d1yr7a_: 1yr7 A: [123910] automated match to d1yr6a1 complexed with gsp |
PDB Entry: 1yr7 (more details), 2.08 Å
SCOPe Domain Sequences for d1yr7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yr7a_ c.37.1.10 (A:) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} smivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyepsidvrefvtveei mregygpngaivesydrlmekfneylnkilrlekendyvlidtpgqmetflfhefgvrlm enlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnkvdllseeekerhr kyfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsaktregfedletlaye hyc
Timeline for d1yr7a_: