Lineage for d1yr0a1 (1yr0 A:4-166)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2574995Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2575207Protein Phosphinothricin acetyltransferase [143698] (1 species)
  7. 2575208Species Agrobacterium tumefaciens [TaxId:358] [143699] (1 PDB entry)
    Uniprot Q8UGX8 2-164
  8. 2575209Domain d1yr0a1: 1yr0 A:4-166 [123905]
    Other proteins in same PDB: d1yr0b_, d1yr0c_, d1yr0d_
    complexed with so4

Details for d1yr0a1

PDB Entry: 1yr0 (more details), 2 Å

PDB Description: crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
PDB Compounds: (A:) phosphinothricin acetyltransferase

SCOPe Domain Sequences for d1yr0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]}
svelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpvivaild
gkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvliaa
ieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelkl

SCOPe Domain Coordinates for d1yr0a1:

Click to download the PDB-style file with coordinates for d1yr0a1.
(The format of our PDB-style files is described here.)

Timeline for d1yr0a1: