SCOPe 2.01: Domain d1yqya2: 1yqy A:265-550

Lineage for d1yqya2 (1yqy A:265-550)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Anthrax toxin lethal factor, middle domain [69845] (1 species)
   includes an all-alpha insert subdomain

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69846] (9 PDB entries)

8. Domain d1yqya2: 1yqy A:265-550 [123904]
   Other proteins in same PDB: d1yqya1
   automatically matched to d1j7na3
   complexed with 915, zn

Details for d1yqya2

PDB Entry: 1yqy, 2.3 Å

PDB Description: Structure of B. Anthrax Lethal factor in complex with a hydroxamate inhibitor

PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d1yqya2:

Sequence; same for both SEQRES and ATOM records:

>d1yqya2 d.166.1.1 (A:265-550) Anthrax toxin lethal factor, middle domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
lsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqi
dssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldiq
pydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmnin
nltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwriq
lspdtragylengklilqrnigleikdvqiikqsekeyiridakvv

Timeline for d1yqya2:

• d1yqya2 first appeared in SCOP 1.73
  
• d1yqya2 appears in SCOP 1.75
  
• d1yqya2 appears in SCOPe 2.02
  
• d1yqya2 appears in the current release, SCOPe 2.08