![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
![]() | Protein Anthrax toxin lethal factor, middle domain [69845] (1 species) includes an all-alpha insert subdomain |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69846] (9 PDB entries) |
![]() | Domain d1yqya2: 1yqy A:265-550 [123904] Other proteins in same PDB: d1yqya1, d1yqya3 automated match to d1j7na3 complexed with 915, zn |
PDB Entry: 1yqy (more details), 2.3 Å
SCOPe Domain Sequences for d1yqya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yqya2 d.166.1.1 (A:265-550) Anthrax toxin lethal factor, middle domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} lsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqi dssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldiq pydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmnin nltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwriq lspdtragylengklilqrnigleikdvqiikqsekeyiridakvv
Timeline for d1yqya2: