Lineage for d1yqya2 (1yqy A:265-550)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000430Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 3000431Protein Anthrax toxin lethal factor, middle domain [69845] (1 species)
    includes an all-alpha insert subdomain
  7. 3000432Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69846] (9 PDB entries)
  8. 3000433Domain d1yqya2: 1yqy A:265-550 [123904]
    Other proteins in same PDB: d1yqya1, d1yqya3
    automated match to d1j7na3
    complexed with 915, zn

Details for d1yqya2

PDB Entry: 1yqy (more details), 2.3 Å

PDB Description: Structure of B. Anthrax Lethal factor in complex with a hydroxamate inhibitor
PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d1yqya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqya2 d.166.1.1 (A:265-550) Anthrax toxin lethal factor, middle domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
lsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqi
dssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldiq
pydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmnin
nltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwriq
lspdtragylengklilqrnigleikdvqiikqsekeyiridakvv

SCOPe Domain Coordinates for d1yqya2:

Click to download the PDB-style file with coordinates for d1yqya2.
(The format of our PDB-style files is described here.)

Timeline for d1yqya2: