SCOP 1.73: Domain d1yqvl2: 1yqv L:108-212

Lineage for d1yqvl2 (1yqv L:108-212)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d1yqvl2: 1yqv L:108-212 [123901]
   Other proteins in same PDB: d1yqvl1, d1yqvy1
   automatically matched to d1eo8l2

Details for d1yqvl2

PDB Entry: 1yqv, 1.7 Å

PDB Description: the crystal structure of the antibody fab hyhel5 complex with lysozyme at 1.7a resolution

PDB Compounds: (L:) HyHEL-5 Antibody Light Chain

SCOP Domain Sequences for d1yqvl2:

Sequence; same for both SEQRES and ATOM records:

>d1yqvl2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d1yqvl2:

• d1yqvl2 is new in SCOP 1.73
  
• d1yqvl2 appears in SCOP 1.75
  
• d1yqvl2 appears in the current release, SCOPe 2.08