Lineage for d1yqvl1 (1yqv L:2-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 783142Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (44 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 783143Domain d1yqvl1: 1yqv L:2-107 [123900]
    Other proteins in same PDB: d1yqvh1, d1yqvl2, d1yqvy1
    automatically matched to d1eo8l1

Details for d1yqvl1

PDB Entry: 1yqv (more details), 1.7 Å

PDB Description: the crystal structure of the antibody fab hyhel5 complex with lysozyme at 1.7a resolution
PDB Compounds: (L:) HyHEL-5 Antibody Light Chain

SCOP Domain Sequences for d1yqvl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
ivltqspaimsaspgekvtmtcsasssvnymywyqqksgtspkrwiydtsklasgvpvrf
sgsgsgtsysltissmetedaatyycqqwgrnptfgggtkleik

SCOP Domain Coordinates for d1yqvl1:

Click to download the PDB-style file with coordinates for d1yqvl1.
(The format of our PDB-style files is described here.)

Timeline for d1yqvl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yqvl2