Lineage for d1yqoa1 (1yqo A:3-455)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646332Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 646333Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 646334Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 646395Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 646396Species Bacillus megaterium [TaxId:1404] [48269] (18 PDB entries)
  8. 646407Domain d1yqoa1: 1yqo A:3-455 [123895]
    automatically matched to d1faha_
    complexed with hem; mutant

Details for d1yqoa1

PDB Entry: 1yqo (more details), 1.9 Å

PDB Description: t268a mutant heme domain of flavocytochrome p450 bm3
PDB Compounds: (A:) bifunctional p-450:nadph-p450 reductase

SCOP Domain Sequences for d1yqoa1:

Sequence, based on SEQRES records: (download)

>d1yqoa1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkd
petgeplddeniryqiitfliagheatsgllsfalyflvknphvlqkaaeeaarvlvdpv
psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkipl

Sequence, based on observed residues (ATOM records): (download)

>d1yqoa1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnklnkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeni
ryqiitfliagheatsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyv
gmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveef
rperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldik
etltlkpegfvvkakskkipl

SCOP Domain Coordinates for d1yqoa1:

Click to download the PDB-style file with coordinates for d1yqoa1.
(The format of our PDB-style files is described here.)

Timeline for d1yqoa1: