SCOP 1.75: Domain d1yqma1: 1yqm A:136-325

Lineage for d1yqma1 (1yqm A:136-325)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (6 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)

6. Protein 8-oxoguanine glycosylase [48160] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48161] (23 PDB entries)

8. Domain d1yqma1: 1yqm A:136-325 [123893]
   Other proteins in same PDB: d1yqma2
   automatically matched to d1ebma1
   complexed with 7gu, ca; mutant

Details for d1yqma1

PDB Entry: 1yqm, 2.5 Å

PDB Description: catalytically inactive human 8-oxoguanine glycosylase crosslinked to 7-deazaguanine containing dna

PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOP Domain Sequences for d1yqma1:

Sequence; same for both SEQRES and ATOM records:

>d1yqma1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtqvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

Timeline for d1yqma1:

• d1yqma1 first appeared in SCOP 1.73
  
• d1yqma1 appears in SCOPe 2.01
  
• d1yqma1 appears in the current release, SCOPe 2.08