Lineage for d1yqma1 (1yqm A:136-325)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645404Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 645405Superfamily a.96.1: DNA-glycosylase [48150] (6 families) (S)
  5. 645439Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)
  6. 645448Protein 8-oxoguanine glycosylase [48160] (1 species)
  7. 645449Species Human (Homo sapiens) [TaxId:9606] [48161] (23 PDB entries)
  8. 645465Domain d1yqma1: 1yqm A:136-325 [123893]
    Other proteins in same PDB: d1yqma2
    automatically matched to d1ebma1
    complexed with 7gu, ca; mutant

Details for d1yqma1

PDB Entry: 1yqm (more details), 2.5 Å

PDB Description: catalytically inactive human 8-oxoguanine glycosylase crosslinked to 7-deazaguanine containing dna
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOP Domain Sequences for d1yqma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqma1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtqvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

SCOP Domain Coordinates for d1yqma1:

Click to download the PDB-style file with coordinates for d1yqma1.
(The format of our PDB-style files is described here.)

Timeline for d1yqma1: