Lineage for d1yqla2 (1yql A:12-135)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins)
    contains a single copy of this fold
  6. Protein 8-oxoguanine glycosylase [55955] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)
  8. Domain d1yqla2: 1yql A:12-135 [123892]
    Other proteins in same PDB: d1yqla1, d1yqla3
    automated match to d2noia1
    protein/DNA complex; complexed with ca

Details for d1yqla2

PDB Entry: 1yql (more details), 2.6 Å

PDB Description: Catalytically inactive hOGG1 crosslinked with 7-deaza-8-azaguanine containing DNA
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d1yqla2:

Sequence, based on SEQRES records: (download)

>d1yqla2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

Sequence, based on observed residues (ATOM records): (download)

>d1yqla2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrllr
q

SCOPe Domain Coordinates for d1yqla2 are not available.

Timeline for d1yqla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yqla1, d1yqla3