Lineage for d1yqla1 (1yql A:136-325)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. Protein 8-oxoguanine glycosylase [48160] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48161] (24 PDB entries)
  8. Domain d1yqla1: 1yql A:136-325 [123891]
    Other proteins in same PDB: d1yqla2, d1yqla3
    automated match to d2noia2
    protein/DNA complex; complexed with ca

Details for d1yqla1

PDB Entry: 1yql (more details), 2.6 Å

PDB Description: Catalytically inactive hOGG1 crosslinked with 7-deaza-8-azaguanine containing DNA
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d1yqla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqla1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtqvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

SCOPe Domain Coordinates for d1yqla1 are not available.

Timeline for d1yqla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yqla2, d1yqla3