![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) ![]() |
![]() | Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins) contains a single copy of this fold |
![]() | Protein 8-oxoguanine glycosylase [55955] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries) |
![]() | Domain d1yqka2: 1yqk A:12-135 [123890] Other proteins in same PDB: d1yqka1, d1yqka3 automatically matched to d1ebma2 protein/DNA complex; complexed with ca, gol |
PDB Entry: 1yqk (more details), 2.5 Å
SCOPe Domain Sequences for d1yqka2:
Sequence, based on SEQRES records: (download)
>d1yqka2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr llrq
>d1yqka2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee qlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrllr q
Timeline for d1yqka2: