SCOP 1.73: Domain d1yqka1: 1yqk A:136-323

Lineage for d1yqka1 (1yqk A:136-323)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (6 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)

6. Protein 8-oxoguanine glycosylase [48160] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48161] (23 PDB entries)

8. Domain d1yqka1: 1yqk A:136-323 [123889]
   Other proteins in same PDB: d1yqka2
   automatically matched to d1ebma1
   complexed with ca, gol; mutant

Details for d1yqka1

PDB Entry: 1yqk, 2.5 Å

PDB Description: human 8-oxoguanine glycosylase crosslinked with guanine containing dna

PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOP Domain Sequences for d1yqka1:

Sequence; same for both SEQRES and ATOM records:

>d1yqka1 a.96.1.3 (A:136-323) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadl

Timeline for d1yqka1:

• d1yqka1 is new in SCOP 1.73
  
• d1yqka1 appears in SCOP 1.75
  
• d1yqka1 appears in the current release, SCOPe 2.08