![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.96.1: DNA-glycosylase [48150] (6 families) ![]() |
![]() | Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins) |
![]() | Protein 8-oxoguanine glycosylase [48160] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48161] (23 PDB entries) |
![]() | Domain d1yqka1: 1yqk A:136-323 [123889] Other proteins in same PDB: d1yqka2 automatically matched to d1ebma1 complexed with ca, gol; mutant |
PDB Entry: 1yqk (more details), 2.5 Å
SCOP Domain Sequences for d1yqka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yqka1 a.96.1.3 (A:136-323) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} dpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq avlfsadl
Timeline for d1yqka1: