SCOPe 2.08: Domain d1yqfe_: 1yqf E:

Lineage for d1yqfe_ (1yqf E:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.25: Mitochondrial glycoprotein MAM33-like [54528] (1 superfamily)
   core: beta(7)-alpha(2); N- and C-terminal extensions form a coiled coil subdomain

4. Superfamily d.25.1: Mitochondrial glycoprotein MAM33-like [54529] (2 families)

5. Family d.25.1.1: Mitochondrial glycoprotein MAM33-like [54530] (2 proteins)

6. Protein Hypothetical protein Lmaj011689 [143110] (1 species)

7. Species Leishmania major [TaxId:5664] [143111] (1 PDB entry)
   Uniprot Q4Q7K6 14-195

8. Domain d1yqfe_: 1yqf E: [123884]
   automated match to d1yqfa1

Details for d1yqfe_

PDB Entry: 1yqf, 2.3 Å

PDB Description: hypothetical protein from leishmania major unknown function sequence homologue to human p32 protein

PDB Compounds: (E:) hypothetical protein Lmaj011689

SCOPe Domain Sequences for d1yqfe_:

Sequence, based on SEQRES records:

>d1yqfe_ d.25.1.1 (E:) Hypothetical protein Lmaj011689 {Leishmania major [TaxId: 5664]}
asdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvrys
tnqdsdkanshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeak
rnelytgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkf
as

Sequence, based on observed residues (ATOM records):

>d1yqfe_ d.25.1.1 (E:) Hypothetical protein Lmaj011689 {Leishmania major [TaxId: 5664]}
asdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvrys
tnqdsnshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeakrne
lytgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkfas

Timeline for d1yqfe_:

• d1yqfe_ first appeared in SCOP 1.73, called d1yqfe1
  
• d1yqfe_ appears in SCOPe 2.07