Lineage for d1yqfe_ (1yqf E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941313Fold d.25: Mitochondrial glycoprotein MAM33-like [54528] (1 superfamily)
    core: beta(7)-alpha(2); N- and C-terminal extensions form a coiled coil subdomain
  4. 2941314Superfamily d.25.1: Mitochondrial glycoprotein MAM33-like [54529] (2 families) (S)
  5. 2941315Family d.25.1.1: Mitochondrial glycoprotein MAM33-like [54530] (2 proteins)
  6. 2941324Protein Hypothetical protein Lmaj011689 [143110] (1 species)
  7. 2941325Species Leishmania major [TaxId:5664] [143111] (1 PDB entry)
    Uniprot Q4Q7K6 14-195
  8. 2941330Domain d1yqfe_: 1yqf E: [123884]
    automated match to d1yqfa1

Details for d1yqfe_

PDB Entry: 1yqf (more details), 2.3 Å

PDB Description: hypothetical protein from leishmania major unknown function sequence homologue to human p32 protein
PDB Compounds: (E:) hypothetical protein Lmaj011689

SCOPe Domain Sequences for d1yqfe_:

Sequence, based on SEQRES records: (download)

>d1yqfe_ d.25.1.1 (E:) Hypothetical protein Lmaj011689 {Leishmania major [TaxId: 5664]}
asdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvrys
tnqdsdkanshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeak
rnelytgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkf
as

Sequence, based on observed residues (ATOM records): (download)

>d1yqfe_ d.25.1.1 (E:) Hypothetical protein Lmaj011689 {Leishmania major [TaxId: 5664]}
asdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvrys
tnqdsnshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeakrne
lytgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkfas

SCOPe Domain Coordinates for d1yqfe_:

Click to download the PDB-style file with coordinates for d1yqfe_.
(The format of our PDB-style files is described here.)

Timeline for d1yqfe_: