SCOP 1.75: Domain d1yqfd1: 1yqf D:14-195

Lineage for d1yqfd1 (1yqf D:14-195)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.25: Mitochondrial glycoprotein MAM33-like [54528] (1 superfamily)
   core: beta(7)-alpha(2); N- and C-terminal extensions form a coiled coil subdomain

4. Superfamily d.25.1: Mitochondrial glycoprotein MAM33-like [54529] (1 family)

5. Family d.25.1.1: Mitochondrial glycoprotein MAM33-like [54530] (2 proteins)

6. Protein Hypothetical protein Lmaj011689 [143110] (1 species)

7. Species Leishmania major [TaxId:5664] [143111] (1 PDB entry)
   Uniprot Q4Q7K6 14-195

8. Domain d1yqfd1: 1yqf D:14-195 [123883]
   automatically matched to 1YQF A:14-195

Details for d1yqfd1

PDB Entry: 1yqf, 2.3 Å

PDB Description: hypothetical protein from leishmania major unknown function sequence homologue to human p32 protein

PDB Compounds: (D:) hypothetical protein Lmaj011689

SCOP Domain Sequences for d1yqfd1:

Sequence; same for both SEQRES and ATOM records:

>d1yqfd1 d.25.1.1 (D:14-195) Hypothetical protein Lmaj011689 {Leishmania major [TaxId: 5664]}
asdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvrys
tnqdsdkanshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeak
rnelytgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkf
as

Timeline for d1yqfd1:

• d1yqfd1 first appeared in SCOP 1.73
  
• d1yqfd1 appears in SCOPe 2.01
  
• d1yqfd1 appears in the current release, SCOPe 2.08, called d1yqfd_