SCOP 1.73: Domain d1yqfc1: 1yqf C:15-195

Lineage for d1yqfc1 (1yqf C:15-195)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.25: Mitochondrial glycoprotein MAM33-like [54528] (1 superfamily)
   core: beta(7)-alpha(2); N- and C-terminal extensions form a coiled coil subdomain

4. Superfamily d.25.1: Mitochondrial glycoprotein MAM33-like [54529] (1 family)

5. Family d.25.1.1: Mitochondrial glycoprotein MAM33-like [54530] (2 proteins)

6. Protein Hypothetical protein Lmaj011689 [143110] (1 species)

7. Species Leishmania major [TaxId:5664] [143111] (1 PDB entry)

8. Domain d1yqfc1: 1yqf C:15-195 [123882]
   automatically matched to 1YQF A:14-195

Details for d1yqfc1

PDB Entry: 1yqf, 2.3 Å

PDB Description: hypothetical protein from leishmania major unknown function sequence homologue to human p32 protein

PDB Compounds: (C:) hypothetical protein Lmaj011689

SCOP Domain Sequences for d1yqfc1:

Sequence; same for both SEQRES and ATOM records:

>d1yqfc1 d.25.1.1 (C:15-195) Hypothetical protein Lmaj011689 {Leishmania major [TaxId: 5664]}
sdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvryst
nqdsdkanshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeakr
nelytgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkfa
s

Timeline for d1yqfc1:

• d1yqfc1 is new in SCOP 1.73
  
• d1yqfc1 appears in SCOP 1.75
  
• d1yqfc1 appears in the current release, SCOPe 2.08, called d1yqfc_