Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.25: Mitochondrial glycoprotein MAM33-like [54528] (1 superfamily) core: beta(7)-alpha(2); N- and C-terminal extensions form a coiled coil subdomain |
Superfamily d.25.1: Mitochondrial glycoprotein MAM33-like [54529] (2 families) |
Family d.25.1.1: Mitochondrial glycoprotein MAM33-like [54530] (2 proteins) |
Protein Hypothetical protein Lmaj011689 [143110] (1 species) |
Species Leishmania major [TaxId:5664] [143111] (1 PDB entry) Uniprot Q4Q7K6 14-195 |
Domain d1yqfb_: 1yqf B: [123881] automated match to d1yqfa1 |
PDB Entry: 1yqf (more details), 2.3 Å
SCOPe Domain Sequences for d1yqfb_:
Sequence, based on SEQRES records: (download)
>d1yqfb_ d.25.1.1 (B:) Hypothetical protein Lmaj011689 {Leishmania major [TaxId: 5664]} asdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvrys tnqdsdkanshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeak rnelytgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkf as
>d1yqfb_ d.25.1.1 (B:) Hypothetical protein Lmaj011689 {Leishmania major [TaxId: 5664]} asdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvrys tnqdshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeakrnely tgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkfas
Timeline for d1yqfb_: