Lineage for d1yqea1 (1yqe A:1-278)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 702659Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 703395Superfamily c.56.7: AF0625-like [142535] (1 family) (S)
    contains extra C-terminal alpha/beta domain: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134
  5. 703396Family c.56.7.1: AF0625-like [142536] (2 proteins)
    Pfam PF04414; DUF516, binds magnesium ion and pyrophosphate in the putative active site
  6. 703397Protein Hypothetical protein AF0625 [142539] (1 species)
  7. 703398Species Archaeoglobus fulgidus [TaxId:2234] [142540] (1 PDB entry)
  8. 703399Domain d1yqea1: 1yqe A:1-278 [123879]
    complexed with pop

Details for d1yqea1

PDB Entry: 1yqe (more details), 1.83 Å

PDB Description: Crystal Structure of Conserved Protein of Unknown Function AF0625
PDB Compounds: (A:) Hypothetical UPF0204 protein AF0625

SCOP Domain Sequences for d1yqea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqea1 c.56.7.1 (A:1-278) Hypothetical protein AF0625 {Archaeoglobus fulgidus [TaxId: 2234]}
mklvvcsesdtagqnikdnlltfadfeekdvgefklylsdefyiaetkerliyadhidek
lakyidfeeilfasrhsskdgrkiftvhvsgnvgtadfggkpyslakpspqtmknyvlal
rerldrkpefeftmevthhgpseiskpsafyeigsteeewkdreaaevvaeamldairae
kmdwnvavgvggthyaprqteimltttftfghnfakytfehltaeflvkavklseaeyii
ideksvnsavkkivneaaevagvevlkskkvkkdfrlv

SCOP Domain Coordinates for d1yqea1:

Click to download the PDB-style file with coordinates for d1yqea1.
(The format of our PDB-style files is described here.)

Timeline for d1yqea1: