SCOPe 2.08: Domain d1yqea1: 1yqe A:1-278

Lineage for d1yqea1 (1yqe A:1-278)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.7: AF0625-like [142535] (1 family)
   contains extra C-terminal alpha/beta domain: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134
   automatically mapped to Pfam PF04414

5. Family c.56.7.1: AF0625-like [142536] (2 proteins)
   Pfam PF04414; DUF516, binds magnesium ion and pyrophosphate in the putative active site

6. Protein Hypothetical protein AF0625 [142539] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [142540] (1 PDB entry)
   Uniprot O29630 1-278

8. Domain d1yqea1: 1yqe A:1-278 [123879]
   Other proteins in same PDB: d1yqea2
   complexed with pop

Details for d1yqea1

PDB Entry: 1yqe, 1.83 Å

PDB Description: Crystal Structure of Conserved Protein of Unknown Function AF0625

PDB Compounds: (A:) Hypothetical UPF0204 protein AF0625

SCOPe Domain Sequences for d1yqea1:

Sequence; same for both SEQRES and ATOM records:

>d1yqea1 c.56.7.1 (A:1-278) Hypothetical protein AF0625 {Archaeoglobus fulgidus [TaxId: 2234]}
mklvvcsesdtagqnikdnlltfadfeekdvgefklylsdefyiaetkerliyadhidek
lakyidfeeilfasrhsskdgrkiftvhvsgnvgtadfggkpyslakpspqtmknyvlal
rerldrkpefeftmevthhgpseiskpsafyeigsteeewkdreaaevvaeamldairae
kmdwnvavgvggthyaprqteimltttftfghnfakytfehltaeflvkavklseaeyii
ideksvnsavkkivneaaevagvevlkskkvkkdfrlv

Timeline for d1yqea1:

• d1yqea1 first appeared in SCOP 1.73
  
• d1yqea1 appears in SCOPe 2.07