SCOPe 2.06: Domain d1yqcb_: 1yqc B:

Lineage for d1yqcb_ (1yqc B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein)
   Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold

6. Protein Ureidoglycolate hydrolase AllA [117313] (4 species)

7. Species Escherichia coli [TaxId:562] [141604] (1 PDB entry)
   Uniprot P63486 1-160

8. Domain d1yqcb_: 1yqc B: [123878]
   automated match to d1xsra_
   complexed with glv

Details for d1yqcb_

PDB Entry: 1yqc, 1.71 Å

PDB Description: crystal structure of ureidoglycolate hydrolase (alla) from escherichia coli o157:h7

PDB Compounds: (B:) Ureidoglycolate hydrolase

SCOPe Domain Sequences for d1yqcb_:

Sequence; same for both SEQRES and ATOM records:

>d1yqcb_ b.82.1.14 (B:) Ureidoglycolate hydrolase AllA {Escherichia coli [TaxId: 562]}
mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq
panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa

Timeline for d1yqcb_:

• d1yqcb_ first appeared in SCOP 1.73, called d1yqcb1
  
• d1yqcb_ appears in SCOPe 2.05
  
• d1yqcb_ appears in SCOPe 2.07
  
• d1yqcb_ appears in the current release, SCOPe 2.08