Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein) Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold |
Protein Ureidoglycolate hydrolase AllA [117313] (4 species) |
Species Escherichia coli [TaxId:562] [141604] (1 PDB entry) Uniprot P63486 1-160 |
Domain d1yqcb_: 1yqc B: [123878] automated match to d1xsra_ complexed with glv |
PDB Entry: 1yqc (more details), 1.71 Å
SCOPe Domain Sequences for d1yqcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yqcb_ b.82.1.14 (B:) Ureidoglycolate hydrolase AllA {Escherichia coli [TaxId: 562]} mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraq panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa
Timeline for d1yqcb_: